PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9483804g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 330aa    MW: 37198 Da    PI: 10.2721
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9483804g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +++++G g+W++ +++ g+ R++k+c++rw +yl
  MA_9483804g0010 14 KGPWTPEEDQKLVAYIQEHGHGSWRALPQKAGLLRCGKSCRLRWANYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.14.3e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++t+E++ +++++++lG++ W+tIa +++ +Rt++++k++w+++l
  MA_9483804g0010  67 RGKFSTQEEQTIIQLHALLGNR-WSTIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.608961IPR017930Myb domain
SuperFamilySSF466892.64E-3011108IPR009057Homeodomain-like
SMARTSM007173.6E-141363IPR001005SANT/Myb domain
PfamPF002496.1E-171461IPR001005SANT/Myb domain
CDDcd001671.81E-101661No hitNo description
PROSITE profilePS5129426.4362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2665116IPR009057Homeodomain-like
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1667112IPR001005SANT/Myb domain
CDDcd001675.85E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGPWTPE EDQKLVAYIQ EHGHGSWRAL PQKAGLLRCG KSCRLRWANY  60
LRPDIKRGKF STQEEQTIIQ LHALLGNRWS TIATHLPKRT DNEIKNYWNT HLKKRLLQMG  120
IDPVTHKPKS ESIMAVGRQS SNGSSNLSHM AQWESARLEA ESRLARESKL RAKGLWSASM  180
RNANVSSDIF SRLRRDSQGF DSDKEELKTR GLNSTGGFEC MKITQKWDKS QDLRLGAKSD  240
QCNSSALGGP FRGYKYNPLE NGQSENRASK TSYVSLLQQA MCPSAQGSKI LYNEAKKLVE  300
NQKNRQANAA ATAYNVHQSH ENCGESKYNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0872630.0EF087263.1 Picea sitchensis clone WS02737_G10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032600.11e-106Myb domain protein 106
TrEMBLA9P0V40.0A9P0V4_PICSI; Putative uncharacterized protein
STRINGVIT_14s0108g01080.t011e-104(Vitis vinifera)
STRINGPGSC0003DMT4000033821e-104(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.21e-103myb domain protein 16